Lineage for d1w8rh_ (1w8r H:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2443025Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2443602Protein automated matches [190095] (28 species)
    not a true protein
  7. 2443969Species Thermoproteus tenax [TaxId:2271] [186816] (2 PDB entries)
  8. 2443986Domain d1w8rh_: 1w8r H: [303258]
    automated match to d2ycee_
    complexed with f2p

Details for d1w8rh_

PDB Entry: 1w8r (more details), 1.93 Å

PDB Description: the mechanism of the schiff base forming fructose-1,6-bisphosphate aldolase: structural analysis of reaction intermediates
PDB Compounds: (H:) fructose-bisphosphate aldolase class I

SCOPe Domain Sequences for d1w8rh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w8rh_ c.1.10.1 (H:) automated matches {Thermoproteus tenax [TaxId: 2271]}
nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
mfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgadamkikytg
dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
faralaelvy

SCOPe Domain Coordinates for d1w8rh_:

Click to download the PDB-style file with coordinates for d1w8rh_.
(The format of our PDB-style files is described here.)

Timeline for d1w8rh_: