Lineage for d1vyya_ (1vyy A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) (S)
  5. Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins)
    automatically mapped to Pfam PF07472
  6. Protein Mannose-specific lectin RS-IIL [101593] (1 species)
  7. Species Ralstonia solanacearum [TaxId:305] [101594] (3 PDB entries)
  8. Domain d1vyya_: 1vyy A: [303250]
    automated match to d1uqxa_
    complexed with ca, unk

Details for d1vyya_

PDB Entry: 1vyy (more details), 1 Å

PDB Description: ralstonia solanacearum high-affinity mannose-binding lectin at 1.0a resolution in complex with d-mannose
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d1vyya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vyya_ b.115.1.1 (A:) Mannose-specific lectin RS-IIL {Ralstonia solanacearum [TaxId: 305]}
aqqgvftlpantsfgvtafanaantqtiqvlvdnvvkatftgsgtsdkllgsqvlnsgsg
aikiqvsvngkpsdlvsnqtilanklnfamvgsedgtdndyndgiavlnwplg

SCOPe Domain Coordinates for d1vyya_ are not available.

Timeline for d1vyya_: