SCOPe 2.08: Domain d1vpja_: 1vpj A:

Lineage for d1vpja_ (1vpj A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.9: FumA C-terminal domain-like [117457] (1 family)
   automatically mapped to Pfam PF05683

5. Family c.8.9.1: FumA C-terminal domain-like [117458] (1 protein)
   Pfam PF05683

6. Protein Fumarate hydratase class I beta subunit [117459] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [117460] (2 PDB entries)
   Uniprot O29167 # AF1098

8. Domain d1vpja_: 1vpj A: [303248]
   automated match to d2isba_

Details for d1vpja_

PDB Entry: 1vpj, 1.69 Å

PDB Description: Crystal structure of Fumarase (FUM-1) (NP_069927.1) from Archaeoglobus fulgidus at 1.69 A resolution

PDB Compounds: (A:) Fumarase

SCOPe Domain Sequences for d1vpja_:

Sequence; same for both SEQRES and ATOM records:

>d1vpja_ c.8.9.1 (A:) Fumarate hydratase class I beta subunit {Archaeoglobus fulgidus [TaxId: 2234]}
vmeyelrtplvkdqilklkvgdvvyitgeiftardeaharalewmeegkelpfsfdkgvv
yhcgplvkkndewrvvsagpttsarmnpftpkilekvecmgiigkggmseevveamrgka
ayfaftggagalaamsikkvkgvvwedlgmpeavwlleverfgpcivaidahgnslyr

Timeline for d1vpja_:

• d1vpja_ first appeared in SCOPe 2.06
  
• d1vpja_ appears in SCOPe 2.07