Lineage for d1vpga_ (1vpg A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily)
    an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity
  4. Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (4 families) (S)
  5. Family d.278.1.2: TRAPP components [118076] (3 proteins)
    Pfam PF04051; form homo- and hetero-dimers with the first two helices of one subunit complementing the fold of the other subunit to the H-NOX domain fold
  6. Protein automated matches [190535] (2 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [187891] (4 PDB entries)
  8. Domain d1vpga_: 1vpg A: [303246]
    automated match to d1wc8a_
    complexed with unl

Details for d1vpga_

PDB Entry: 1vpg (more details), 2.1 Å

PDB Description: Crystal structure of BET3 homolog (13277653) from Mus musculus at 2.10 A resolution
PDB Compounds: (A:) Trafficking protein particle complex subunit 3

SCOPe Domain Sequences for d1vpga_:

Sequence, based on SEQRES records: (download)

>d1vpga_ d.278.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kmsselftltygalvtqlckdyendedvnkqldrmgynigvrliedflarsnvgrchdfr
etadviakvafkmylgitpsitnwspagdefslilennplvdfvelpdnhsaliysnllc
gvlrgalemvqmaveakfvqdtlkgdgvteirmrfirri

Sequence, based on observed residues (ATOM records): (download)

>d1vpga_ d.278.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kmsselftltygalvtqlckdyendedvnkqldrmgynigvrliedflarsnvgrchdfr
etadviakvafkmylgitpsitnwspagdefslilennplnhsaliysnllcgvlrgale
mvqmaveakfvqdtlkgdgvteirmrfirri

SCOPe Domain Coordinates for d1vpga_ are not available.

Timeline for d1vpga_:

Domains from other chains:
(mouse over for more information)
d1vpgb_