Lineage for d1vjpa4 (1vjp A:210-316)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2203126Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2203127Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2203521Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 2203595Protein Hypothetical protein TM1419 [103105] (1 species)
    myo-inositol 1-phosphate synthase-related protein
  7. 2203596Species Thermotoga maritima [TaxId:2336] [103106] (2 PDB entries)
  8. 2203598Domain d1vjpa4: 1vjp A:210-316 [303244]
    Other proteins in same PDB: d1vjpa3, d1vjpa5
    automated match to d3cina2
    complexed with cl, mg, nad

Details for d1vjpa4

PDB Entry: 1vjp (more details), 1.7 Å

PDB Description: Crystal structure of MYO-inositol-1-phosphate synthase-related protein (TM1419) from Thermotoga maritima at 1.70 A resolution
PDB Compounds: (A:) Myo-inositol-1-phosphate synthase-related protein

SCOPe Domain Sequences for d1vjpa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjpa4 d.81.1.3 (A:210-316) Hypothetical protein TM1419 {Thermotoga maritima [TaxId: 2336]}
atgatpftadvlshlaqrnryvkdvaqfniggnmdflaltddgknkskeftkssivkdil
gydaphyikptgyleplgdkkfiaihieyvsfngatdelmingrind

SCOPe Domain Coordinates for d1vjpa4:

Click to download the PDB-style file with coordinates for d1vjpa4.
(The format of our PDB-style files is described here.)

Timeline for d1vjpa4: