Lineage for d1vjjb7 (1vjj B:473-593)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763296Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) (S)
    automatically mapped to Pfam PF00927
  5. 2763297Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 2763298Protein Transglutaminase, two C-terminal domains [49311] (4 species)
    duplication
  7. 2763336Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74850] (9 PDB entries)
  8. 2763339Domain d1vjjb7: 1vjj B:473-593 [303241]
    Other proteins in same PDB: d1vjja5, d1vjja6, d1vjjb5, d1vjjb6
    automated match to d1l9ma2
    complexed with ca, cl, gdp, mg

Details for d1vjjb7

PDB Entry: 1vjj (more details), 1.9 Å

PDB Description: Structural Basis for the Coordinated Regulation of Transglutaminase 3 by Guanine Nucleotides and Calcium/Magnesium
PDB Compounds: (B:) Protein-glutamine glutamyltransferase E

SCOPe Domain Sequences for d1vjjb7:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjjb7 b.1.5.1 (B:473-593) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
leteeqepsiigklkvagmlavgkevnlvlllknlsrdtktvtvnmtawtiiyngtlvhe
vwkdsatmsldpeeeaehpikisyaqyerylksdnmiritavckvpdesevvverdiild
n

SCOPe Domain Coordinates for d1vjjb7:

Click to download the PDB-style file with coordinates for d1vjjb7.
(The format of our PDB-style files is described here.)

Timeline for d1vjjb7: