![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.4: Transglutaminase core [54044] (3 proteins) |
![]() | Protein Transglutaminase catalytic domain [54045] (4 species) |
![]() | Species Human (Homo sapiens), TGase E3 [TaxId:9606] [75334] (9 PDB entries) |
![]() | Domain d1vjjb6: 1vjj B:141-459 [303240] Other proteins in same PDB: d1vjja5, d1vjja7, d1vjja8, d1vjjb5, d1vjjb7, d1vjjb8 automated match to d1l9ma4 complexed with ca, cl, gdp, mg |
PDB Entry: 1vjj (more details), 1.9 Å
SCOPe Domain Sequences for d1vjjb6:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vjjb6 d.3.1.4 (B:141-459) Transglutaminase catalytic domain {Human (Homo sapiens), TGase E3 [TaxId: 9606]} dsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqfeedilsiclsildrslnfrr daatdvasrndpkyvgrvlsaminsnddngvlagnwsgtytggrdprswngsveilknwk ksglspvrygqcwvfagtlntalrslgipsrvitnfnsahdtdrnlsvdvyydpmgnpld kgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqersqgvfqcgpasvigvregdvq lnfdmpfifaevnadritwlydnttgkqwknsvnshtigryistkavgsnarmdvtdkyk ypegsdqerqvfqkalgkl
Timeline for d1vjjb6:
![]() Domains from other chains: (mouse over for more information) d1vjja5, d1vjja6, d1vjja7, d1vjja8 |