![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein) |
![]() | Protein Transglutaminase N-terminal domain [49235] (4 species) elaborated with many loop insertions in the common fold |
![]() | Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74845] (9 PDB entries) |
![]() | Domain d1vjjb5: 1vjj B:1-140 [303239] Other proteins in same PDB: d1vjja6, d1vjja7, d1vjja8, d1vjjb6, d1vjjb7, d1vjjb8 automated match to d1l9na1 complexed with ca, cl, gdp, mg |
PDB Entry: 1vjj (more details), 1.9 Å
SCOPe Domain Sequences for d1vjjb5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vjjb5 b.1.18.9 (B:1-140) Transglutaminase N-terminal domain {Human (Homo sapiens), TGase E3 [TaxId: 9606]} aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg gissvklgtfillfnpwlnv
Timeline for d1vjjb5:
![]() Domains from other chains: (mouse over for more information) d1vjja5, d1vjja6, d1vjja7, d1vjja8 |