Lineage for d1vjja5 (1vjj A:1-140)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765693Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)
  6. 2765694Protein Transglutaminase N-terminal domain [49235] (4 species)
    elaborated with many loop insertions in the common fold
  7. 2765714Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74845] (9 PDB entries)
  8. 2765715Domain d1vjja5: 1vjj A:1-140 [303235]
    Other proteins in same PDB: d1vjja6, d1vjja7, d1vjja8, d1vjjb6, d1vjjb7, d1vjjb8
    automated match to d1l9na1
    complexed with ca, cl, gdp, mg

Details for d1vjja5

PDB Entry: 1vjj (more details), 1.9 Å

PDB Description: Structural Basis for the Coordinated Regulation of Transglutaminase 3 by Guanine Nucleotides and Calcium/Magnesium
PDB Compounds: (A:) Protein-glutamine glutamyltransferase E

SCOPe Domain Sequences for d1vjja5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjja5 b.1.18.9 (A:1-140) Transglutaminase N-terminal domain {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
gissvklgtfillfnpwlnv

SCOPe Domain Coordinates for d1vjja5:

Click to download the PDB-style file with coordinates for d1vjja5.
(The format of our PDB-style files is described here.)

Timeline for d1vjja5: