Lineage for d1e1na1 (1e1n A:107-331)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 239501Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 239502Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 239503Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (4 proteins)
  6. 239504Protein Adrenodoxin reductase of mitochondrial p450 systems [51909] (1 species)
  7. 239505Species Cow (Bos taurus) [TaxId:9913] [51910] (6 PDB entries)
  8. 239512Domain d1e1na1: 1e1n A:107-331 [30323]
    Other proteins in same PDB: d1e1na2
    complexed with fad

Details for d1e1na1

PDB Entry: 1e1n (more details), 2.4 Å

PDB Description: structure of adrenodoxin reductase at 2.4 angstrom in crystal form a'

SCOP Domain Sequences for d1e1na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1na1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus)}
hqaldipgeelpgvfsarafvgwynglpenrelapdlscdtavilgqgnvaldvarillt
ppdhlektditeaalgalrqsrvktvwivgrrgplqvaftikelremiqlpgtrpmldpa
dflglqdrikeaarprkrlmelllrtatekpgveeaarrasasrawglrffrspqqvlps
pdgrraagirlavtrlegigeatravptgdvedlpcglvlssigy

SCOP Domain Coordinates for d1e1na1:

Click to download the PDB-style file with coordinates for d1e1na1.
(The format of our PDB-style files is described here.)

Timeline for d1e1na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e1na2