Lineage for d1vfka5 (1vfk A:121-502)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2438501Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2438870Protein Maltogenic amylase, central domain [51465] (4 species)
    contains an additional N-terminal domain
  7. 2438884Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51467] (12 PDB entries)
  8. 2438893Domain d1vfka5: 1vfk A:121-502 [303223]
    Other proteins in same PDB: d1vfka4, d1vfka6, d1vfkb4, d1vfkb6
    automated match to d1bvza3
    complexed with ca, glc

Details for d1vfka5

PDB Entry: 1vfk (more details), 2.9 Å

PDB Description: Crystal structure of Thermoactinomyces vulgaris R-47 alpha-amylase 2/acarbose complex
PDB Compounds: (A:) Neopullulanase 2

SCOPe Domain Sequences for d1vfka5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfka5 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten
pevkeylfdvarfwmeqgidgwrldvanevdhafwrefrrlvkslnpdalivgeiwhdas
gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn
rglfefykelirlrhrlasltr

SCOPe Domain Coordinates for d1vfka5:

Click to download the PDB-style file with coordinates for d1vfka5.
(The format of our PDB-style files is described here.)

Timeline for d1vfka5: