SCOPe 2.07: Domain d1vdza3: 1vdz A:440-588

Lineage for d1vdza3 (1vdz A:440-588)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families)

5. Family a.69.1.2: C-terminal domain of A and B subunits of V1 ATP synthase and A1 ATP sythase [310617] (3 protein domains)

6. Protein A1 ATP synthase A subunit, C-terminal domain [310708] (2 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [310941] (1 PDB entry)

8. Domain d1vdza3: 1vdz A:440-588 [303221]
   Other proteins in same PDB: d1vdza1, d1vdza2
   complexed with mpd

Details for d1vdza3

PDB Entry: 1vdz, 2.55 Å

PDB Description: Crystal structure of A-type ATPase catalytic subunit A from Pyrococcus horikoshii OT3

PDB Compounds: (A:) A-type ATPase subunit A

SCOPe Domain Sequences for d1vdza3:

Sequence; same for both SEQRES and ATOM records:

>d1vdza3 a.69.1.2 (A:440-588) A1 ATP synthase A subunit, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
vdavkdwwhknidpewkamrdkamallqkeselqeivrivgpdalpereraillvarmlr
edylqqdafdevdtycppekqvtmmrvllnfydktmeainrgvpleeiaklpvreeigrm
kferdvskirslidktneqfeelfkkyga

Timeline for d1vdza3:

• d1vdza3 first appeared in SCOPe 2.06