Lineage for d1vdza3 (1vdz A:440-588)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717499Family a.69.1.2: C-terminal domain of A and B subunits of V1 ATP synthase and A1 ATP sythase [310617] (3 proteins)
  6. 2717500Protein A1 ATP synthase A subunit, C-terminal domain [310708] (2 species)
  7. 2717503Species Pyrococcus horikoshii [TaxId:53953] [310941] (1 PDB entry)
  8. 2717504Domain d1vdza3: 1vdz A:440-588 [303221]
    Other proteins in same PDB: d1vdza1, d1vdza2
    complexed with mpd

Details for d1vdza3

PDB Entry: 1vdz (more details), 2.55 Å

PDB Description: Crystal structure of A-type ATPase catalytic subunit A from Pyrococcus horikoshii OT3
PDB Compounds: (A:) A-type ATPase subunit A

SCOPe Domain Sequences for d1vdza3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdza3 a.69.1.2 (A:440-588) A1 ATP synthase A subunit, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
vdavkdwwhknidpewkamrdkamallqkeselqeivrivgpdalpereraillvarmlr
edylqqdafdevdtycppekqvtmmrvllnfydktmeainrgvpleeiaklpvreeigrm
kferdvskirslidktneqfeelfkkyga

SCOPe Domain Coordinates for d1vdza3:

Click to download the PDB-style file with coordinates for d1vdza3.
(The format of our PDB-style files is described here.)

Timeline for d1vdza3: