Lineage for d1vdza2 (1vdz A:114-190)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817843Superfamily b.84.5: V1 ATP synthase A subunit, bulge domain-like [310577] (1 family) (S)
    PubMed 19893485
  5. 2817844Family b.84.5.1: V1 ATP synthase A subunit, bulge domain-like [310616] (2 proteins)
  6. 2817845Protein A1 ATP synthase A subunit, bulge domain [310707] (2 species)
  7. 2817848Species Pyrococcus horikoshii [TaxId:53953] [310938] (1 PDB entry)
  8. 2817849Domain d1vdza2: 1vdz A:114-190 [303220]
    Other proteins in same PDB: d1vdza1, d1vdza3
    complexed with mpd

Details for d1vdza2

PDB Entry: 1vdz (more details), 2.55 Å

PDB Description: Crystal structure of A-type ATPase catalytic subunit A from Pyrococcus horikoshii OT3
PDB Compounds: (A:) A-type ATPase subunit A

SCOPe Domain Sequences for d1vdza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdza2 b.84.5.1 (A:114-190) A1 ATP synthase A subunit, bulge domain {Pyrococcus horikoshii [TaxId: 53953]}
rdkkwhfipkakvgdkvvggdiigevpetsiivhkimvppgiegeiveiaeegdytieev
iakvktpsgeikelkmy

SCOPe Domain Coordinates for d1vdza2:

Click to download the PDB-style file with coordinates for d1vdza2.
(The format of our PDB-style files is described here.)

Timeline for d1vdza2: