Lineage for d1vdza1 (1vdz A:60-113,A:191-439)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112131Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 protein domains)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2058580Protein A1 ATP synthase A subunit, central domain [310704] (2 species)
  7. 2058583Species Pyrococcus horikoshii [TaxId:53953] [310932] (1 PDB entry)
  8. 2058584Domain d1vdza1: 1vdz A:60-113,A:191-439 [303219]
    Other proteins in same PDB: d1vdza2, d1vdza3
    complexed with mpd

Details for d1vdza1

PDB Entry: 1vdz (more details), 2.55 Å

PDB Description: Crystal structure of A-type ATPase catalytic subunit A from Pyrococcus horikoshii OT3
PDB Compounds: (A:) A-type ATPase subunit A

SCOPe Domain Sequences for d1vdza1:

Sequence, based on SEQRES records: (download)

>d1vdza1 c.37.1.11 (A:60-113,A:191-439) A1 ATP synthase A subunit, central domain {Pyrococcus horikoshii [TaxId: 53953]}
rpgepvvgtgaslsvelgpglltsiydgiqrplevirektgdfiargvtapalpXqrwpv
rvkrpykeklppevplitgqrvidtffpqakggtaaipgpfgsgktvtqhqlakwsdaqv
viyigcgergnemtdvleefpklkdpktgkplmertvliantsnmpvaareasiytgiti
aeyfrdmgydvalmadstsrwaealreisgrleempgeegypaylasklaefyeragrvv
tlgsdyrvgsvsvigavsppggdfsepvvqntlrvvkvfwaldadlarrrhfpainwlts
ysly

Sequence, based on observed residues (ATOM records): (download)

>d1vdza1 c.37.1.11 (A:60-113,A:191-439) A1 ATP synthase A subunit, central domain {Pyrococcus horikoshii [TaxId: 53953]}
rpgepvvgtgaslsvelgpglltsiydgiqrplevirektgdfiargvtapalpXqrwpv
rvkrpykeklppevplitgqrvidtffpqakggtaaipgpfgsgktvtqhqlakwsdaqv
viyigcgergnemtdvleefpklkdpktgkplmertvliantsnmpvaareasiytgiti
aeyfrdmgydvalmadstsrwaealpaylasklaefyeragrvvtlgsdyrvgsvsviga
vsppggdfsepvvqntlrvvkvfwaldadlarrrhfpainwltsysly

SCOPe Domain Coordinates for d1vdza1:

Click to download the PDB-style file with coordinates for d1vdza1.
(The format of our PDB-style files is described here.)

Timeline for d1vdza1:

  • d1vdza1 is new in SCOPe 2.06-stable