Lineage for d1v7ba4 (1v7b A:75-175)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334734Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2334735Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2334736Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2335028Protein Transcriptional regulator Cgl2612 [140895] (1 species)
  7. 2335029Species Corynebacterium glutamicum [TaxId:1718] [140896] (5 PDB entries)
    Uniprot Q8NMG3 75-175
  8. 2335032Domain d1v7ba4: 1v7b A:75-175 [303203]
    Other proteins in same PDB: d1v7ba3, d1v7bb3
    automated match to d2zoya2

Details for d1v7ba4

PDB Entry: 1v7b (more details), 1.9 Å

PDB Description: TetR-family transcription factor CGL2612 from C.glutamicum
PDB Compounds: (A:) Transcriptional regulator

SCOPe Domain Sequences for d1v7ba4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7ba4 a.121.1.1 (A:75-175) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]}
edplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqwipdtddlendahkr
avylvqlaadglfvhdyihddvlskskrqamletilelips

SCOPe Domain Coordinates for d1v7ba4:

Click to download the PDB-style file with coordinates for d1v7ba4.
(The format of our PDB-style files is described here.)

Timeline for d1v7ba4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v7ba3