Lineage for d1v7ba3 (1v7b A:1-74)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692210Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2692508Protein Transcriptional regulator Cgl2612 [140181] (1 species)
  7. 2692509Species Corynebacterium glutamicum [TaxId:1718] [140182] (5 PDB entries)
    Uniprot Q8NMG3 1-174
  8. 2692512Domain d1v7ba3: 1v7b A:1-74 [303202]
    Other proteins in same PDB: d1v7ba4, d1v7bb4
    automated match to d2zoya1

Details for d1v7ba3

PDB Entry: 1v7b (more details), 1.9 Å

PDB Description: TetR-family transcription factor CGL2612 from C.glutamicum
PDB Compounds: (A:) Transcriptional regulator

SCOPe Domain Sequences for d1v7ba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7ba3 a.4.1.9 (A:1-74) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]}
mrtskkemilrtaidyigeysletlsydslaeatglsksgliyhfpsrhalllgmhella
ddwdkelrditrdp

SCOPe Domain Coordinates for d1v7ba3:

Click to download the PDB-style file with coordinates for d1v7ba3.
(The format of our PDB-style files is described here.)

Timeline for d1v7ba3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v7ba4