Lineage for d1uvwa6 (1uvw A:357-511)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771966Protein Spore coat protein A, CotA, N- and C-terminal domain [418912] (2 species)
  7. 2771967Species Bacillus subtilis [TaxId:1423] [419334] (13 PDB entries)
    Uniprot P07788
  8. 2771975Domain d1uvwa6: 1uvw A:357-511 [303200]
    Other proteins in same PDB: d1uvwa5
    automated match to d3zdwa3
    complexed with cu1, ebs, gol, oxy

Details for d1uvwa6

PDB Entry: 1uvw (more details), 2.45 Å

PDB Description: Bacillus subtilis CotA laccase adduct with ABTS
PDB Compounds: (A:) spore coat protein a

SCOPe Domain Sequences for d1uvwa6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uvwa6 b.6.1.3 (A:357-511) Spore coat protein A, CotA, N- and C-terminal domain {Bacillus subtilis [TaxId: 1423]}
sypsvqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptr
gthpihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlr
iaatfgpysgryvwhchilehedydmmrpmditdp

SCOPe Domain Coordinates for d1uvwa6:

Click to download the PDB-style file with coordinates for d1uvwa6.
(The format of our PDB-style files is described here.)

Timeline for d1uvwa6: