| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
| Protein Spore coat protein A, CotA, N- and C-terminal domain [418912] (2 species) |
| Species Bacillus subtilis [TaxId:1423] [419334] (13 PDB entries) Uniprot P07788 |
| Domain d1uvwa6: 1uvw A:357-511 [303200] Other proteins in same PDB: d1uvwa5 automated match to d3zdwa3 complexed with cu1, ebs, gol, oxy |
PDB Entry: 1uvw (more details), 2.45 Å
SCOPe Domain Sequences for d1uvwa6:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uvwa6 b.6.1.3 (A:357-511) Spore coat protein A, CotA, N- and C-terminal domain {Bacillus subtilis [TaxId: 1423]}
sypsvqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptr
gthpihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlr
iaatfgpysgryvwhchilehedydmmrpmditdp
Timeline for d1uvwa6: