Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (2 proteins) |
Protein N-acetyl-l-glutamate kinase [75298] (4 species) |
Species Thermotoga maritima [TaxId:2336] [142720] (2 PDB entries) Uniprot Q9X2A4 1-282 |
Domain d1uvvc_: 1uvv C: [303197] automated match to d2btya1 complexed with arg, k, nlg |
PDB Entry: 1uvv (more details), 2.75 Å
SCOPe Domain Sequences for d1uvvc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uvvc_ c.73.1.2 (C:) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]} mridtvnvllealpyikefygktfvikfggsamkqenakkafiqdiillkytgikpiivh gggpaisqmmkdlgiepvfknghrvtdektmeivemvlvgkinkeivmnlnlhggravgi cgkdsklivaeketkhgdigyvgkvkkvnpeilhaliendyipviapvgigedghsynin adtaaaeiakslmaeklilltdvdgvlkdgklistltpdeaeelirdgtvtggmipkvec avsavrggvgavhiingglehailleifsrkgigtmikeleg
Timeline for d1uvvc_: