Lineage for d1uvva_ (1uvv A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138062Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2138063Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2138082Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (2 protein domains)
  6. 2138083Protein N-acetyl-l-glutamate kinase [75298] (4 species)
  7. 2138111Species Thermotoga maritima [TaxId:2336] [142720] (2 PDB entries)
    Uniprot Q9X2A4 1-282
  8. 2138113Domain d1uvva_: 1uvv A: [303195]
    automated match to d2btya1
    complexed with arg, k, nlg

Details for d1uvva_

PDB Entry: 1uvv (more details), 2.75 Å

PDB Description: acetylglutamate kinase from thermotoga maritima complexed with its inhibitor arginine
PDB Compounds: (A:) acetylglutamate kinase

SCOPe Domain Sequences for d1uvva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uvva_ c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]}
mridtvnvllealpyikefygktfvikfggsamkqenakkafiqdiillkytgikpiivh
gggpaisqmmkdlgiepvfknghrvtdektmeivemvlvgkinkeivmnlnlhggravgi
cgkdsklivaeketkhgdigyvgkvkkvnpeilhaliendyipviapvgigedghsynin
adtaaaeiakslmaeklilltdvdgvlkdgklistltpdeaeelirdgtvtggmipkvec
avsavrggvgavhiingglehailleifsrkgigtmikeleg

SCOPe Domain Coordinates for d1uvva_:

Click to download the PDB-style file with coordinates for d1uvva_.
(The format of our PDB-style files is described here.)

Timeline for d1uvva_:

  • d1uvva_ is new in SCOPe 2.06-stable