Lineage for d1cjca1 (1cjc A:107-331)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 388822Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 388823Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 388824Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (5 proteins)
  6. 388828Protein Adrenodoxin reductase of mitochondrial p450 systems [51909] (1 species)
  7. 388829Species Cow (Bos taurus) [TaxId:9913] [51910] (6 PDB entries)
  8. 388830Domain d1cjca1: 1cjc A:107-331 [30319]
    Other proteins in same PDB: d1cjca2
    complexed with fad

Details for d1cjca1

PDB Entry: 1cjc (more details), 1.7 Å

PDB Description: structure of adrenodoxin reductase of mitochondrial p450 systems

SCOP Domain Sequences for d1cjca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus)}
hqaldipgeelpgvfsarafvgwynglpenrelapdlscdtavilgqgnvaldvarillt
ppdhlektditeaalgalrqsrvktvwivgrrgplqvaftikelremiqlpgtrpmldpa
dflglqdrikeaarprkrlmelllrtatekpgveeaarrasasrawglrffrspqqvlps
pdgrraagirlavtrlegigeatravptgdvedlpcglvlssigy

SCOP Domain Coordinates for d1cjca1:

Click to download the PDB-style file with coordinates for d1cjca1.
(The format of our PDB-style files is described here.)

Timeline for d1cjca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cjca2