![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
![]() | Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) ![]() the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
![]() | Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (2 proteins) |
![]() | Protein N-acetyl-l-glutamate kinase [75298] (4 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [142718] (2 PDB entries) Uniprot Q9HTN2 1-300 |
![]() | Domain d1uvdf_: 1uvd F: [303188] automated match to d2bufa1 complexed with adp, cl, mg, nlg |
PDB Entry: 1uvd (more details), 2.95 Å
SCOPe Domain Sequences for d1uvdf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uvdf_ c.73.1.2 (F:) N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [TaxId: 287]} tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh
Timeline for d1uvdf_: