Lineage for d1uvdb_ (1uvd B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905127Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2905128Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2905147Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (2 proteins)
  6. 2905148Protein N-acetyl-l-glutamate kinase [75298] (4 species)
  7. 2905162Species Pseudomonas aeruginosa [TaxId:287] [142718] (2 PDB entries)
    Uniprot Q9HTN2 1-300
  8. 2905164Domain d1uvdb_: 1uvd B: [303184]
    automated match to d2bufa1
    complexed with adp, cl, mg, nlg

Details for d1uvdb_

PDB Entry: 1uvd (more details), 2.95 Å

PDB Description: arginine feed-back inhibitable acetylglutamate kinase
PDB Compounds: (B:) acetylglutamate kinase

SCOPe Domain Sequences for d1uvdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uvdb_ c.73.1.2 (B:) N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [TaxId: 287]}
tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh

SCOPe Domain Coordinates for d1uvdb_:

Click to download the PDB-style file with coordinates for d1uvdb_.
(The format of our PDB-style files is described here.)

Timeline for d1uvdb_: