Lineage for d1uulj_ (1uul J:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877880Protein automated matches [190100] (21 species)
    not a true protein
  7. 2878323Species Trypanosoma cruzi [TaxId:5693] [311182] (1 PDB entry)
  8. 2878333Domain d1uulj_: 1uul J: [303182]
    automated match to d3qpma_

Details for d1uulj_

PDB Entry: 1uul (more details), 2.8 Å

PDB Description: Tryparedoxin peroxidase (TXNPx) from Trypanosoma cruzi in the reduced state
PDB Compounds: (J:) tryparedoxin peroxidase homologue

SCOPe Domain Sequences for d1uulj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uulj_ c.47.1.10 (J:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
geaedlhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfsdrv
kefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlkeed
gvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpgdkt
mkpdpekskeyfga

SCOPe Domain Coordinates for d1uulj_:

Click to download the PDB-style file with coordinates for d1uulj_.
(The format of our PDB-style files is described here.)

Timeline for d1uulj_: