SCOP 1.55: Domain d2tmdb2: 2tmd B:490-645

Lineage for d2tmdb2 (2tmd B:490-645)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families)

5. Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (3 proteins)

6. Protein Trimethylamine dehydrogenase, C-terminal domain [51907] (1 species)

7. Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51908] (3 PDB entries)

8. Domain d2tmdb2: 2tmd B:490-645 [30318]
   Other proteins in same PDB: d2tmda1, d2tmda3, d2tmdb1, d2tmdb3

Details for d2tmdb2

PDB Entry: 2tmd, 2.4 Å

PDB Description: correlation of x-ray deduced and experimental amino acid sequences of trimethylamine dehydrogenase

SCOP Domain Sequences for d2tmdb2:

Sequence; same for both SEQRES and ATOM records:

>d2tmdb2 c.3.1.1 (B:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1}
rwntdgtnclthdpipgadaslpdqltpeqvmdgkkkigkrvvilnadtyfmapslaekl
ataghevtivsgvhlanymhftleypnmmrrlhelhveelgdhfcsriepgrmeiyniwg
dgskrtyrgpgvsprdantshrwiefdslvlvtgrh

Timeline for d2tmdb2:

• d2tmdb2 appears in SCOP 1.57
  
• d2tmdb2 appears in the current release, SCOPe 2.08