Lineage for d1utwe2 (1utw E:295-432)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051677Family b.29.1.19: Glycosyl hydrolases family 32 C-terminal domain [101652] (2 proteins)
    Pfam PF08244
    flat sheet beta-sandwich lacking the characteristic beta-bulge in the C-terminal strand
  6. 2051678Protein Beta-fructosidase (invertase), C-terminal domain [101653] (1 species)
  7. 2051679Species Thermotoga maritima [TaxId:2336] [101654] (2 PDB entries)
  8. 2051684Domain d1utwe2: 1utw E:295-432 [303170]
    Other proteins in same PDB: d1utwa1, d1utwb1, d1utwc1, d1utwd1, d1utwe1, d1utwf1
    automated match to d1uypa1
    complexed with cit, gol, na, so4

Details for d1utwe2

PDB Entry: 1utw (more details), 1.9 Å

PDB Description: the three-dimensional structure of beta-fructosidase (invertase) from thermotoga maritima
PDB Compounds: (E:) beta-fructosidase

SCOPe Domain Sequences for d1utwe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1utwe2 b.29.1.19 (E:295-432) Beta-fructosidase (invertase), C-terminal domain {Thermotoga maritima [TaxId: 2336]}
vdellalrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdel
ivdttrsgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynils
vksnqvklevfeleniwl

SCOPe Domain Coordinates for d1utwe2:

Click to download the PDB-style file with coordinates for d1utwe2.
(The format of our PDB-style files is described here.)

Timeline for d1utwe2: