Lineage for d2tmda2 (2tmd A:490-645)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1154265Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1154266Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 1154267Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (5 proteins)
  6. 1154308Protein Trimethylamine dehydrogenase, C-terminal domain [51907] (1 species)
    N-terminal domain is beta/alpha barrel and the middle domain is alpha/beta Rossmann-fold
  7. 1154309Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51908] (5 PDB entries)
  8. 1154316Domain d2tmda2: 2tmd A:490-645 [30317]
    Other proteins in same PDB: d2tmda1, d2tmda3, d2tmdb1, d2tmdb3
    complexed with adp, fmn, sf4

Details for d2tmda2

PDB Entry: 2tmd (more details), 2.4 Å

PDB Description: correlation of x-ray deduced and experimental amino acid sequences of trimethylamine dehydrogenase
PDB Compounds: (A:) trimethylamine dehydrogenase

SCOPe Domain Sequences for d2tmda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tmda2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
rwntdgtnclthdpipgadaslpdqltpeqvmdgkkkigkrvvilnadtyfmapslaekl
ataghevtivsgvhlanymhftleypnmmrrlhelhveelgdhfcsriepgrmeiyniwg
dgskrtyrgpgvsprdantshrwiefdslvlvtgrh

SCOPe Domain Coordinates for d2tmda2:

Click to download the PDB-style file with coordinates for d2tmda2.
(The format of our PDB-style files is described here.)

Timeline for d2tmda2: