![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
![]() | Family b.29.1.19: Glycosyl hydrolases family 32 C-terminal domain [101652] (2 proteins) Pfam PF08244 flat sheet beta-sandwich lacking the characteristic beta-bulge in the C-terminal strand |
![]() | Protein Beta-fructosidase (invertase), C-terminal domain [101653] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [101654] (2 PDB entries) |
![]() | Domain d1utwc2: 1utw C:295-432 [303166] Other proteins in same PDB: d1utwa1, d1utwb1, d1utwc1, d1utwd1, d1utwe1, d1utwf1 automated match to d1uypa1 complexed with cit, gol, na, so4 |
PDB Entry: 1utw (more details), 1.9 Å
SCOPe Domain Sequences for d1utwc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1utwc2 b.29.1.19 (C:295-432) Beta-fructosidase (invertase), C-terminal domain {Thermotoga maritima [TaxId: 2336]} vdellalrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdel ivdttrsgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynils vksnqvklevfeleniwl
Timeline for d1utwc2: