SCOPe 2.02: Domain d1djqa2: 1djq A:490-645

Lineage for d1djqa2 (1djq A:490-645)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families)

5. Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (5 proteins)

6. Protein Trimethylamine dehydrogenase, C-terminal domain [51907] (1 species)
   N-terminal domain is beta/alpha barrel and the middle domain is alpha/beta Rossmann-fold

7. Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51908] (5 PDB entries)

8. Domain d1djqa2: 1djq A:490-645 [30315]
   Other proteins in same PDB: d1djqa1, d1djqa3, d1djqb1, d1djqb3
   complexed with adp, fmn, sf4; mutant

Details for d1djqa2

PDB Entry: 1djq, 2.2 Å

PDB Description: structural and biochemical characterization of recombinant c30a mutant of trimethylamine dehydrogenase from methylophilus methylotrophus (sp. w3a1)

PDB Compounds: (A:) trimethylamine dehydrogenase

SCOPe Domain Sequences for d1djqa2:

Sequence; same for both SEQRES and ATOM records:

>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
rwntdgtnclthdpipgadaslpdqltpeqvmdgkkkigkrvvilnadtyfmapslaekl
ataghevtivsgvhlanymhftleypnmmrrlhelhveelgdhfcsriepgrmeiyniwg
dgskrtyrgpgvsprdantshrwiefdslvlvtgrh

Timeline for d1djqa2:

• d1djqa2 first appeared (with stable ids) in SCOP 1.55
  
• d1djqa2 appears in SCOPe 2.01
  
• d1djqa2 appears in SCOPe 2.03
  
• d1djqa2 appears in the current release, SCOPe 2.08