Lineage for d1djqa2 (1djq A:490-645)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67065Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 67066Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 67067Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (3 proteins)
  6. 67087Protein Trimethylamine dehydrogenase, C-terminal domain [51907] (1 species)
  7. 67088Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51908] (3 PDB entries)
  8. 67091Domain d1djqa2: 1djq A:490-645 [30315]
    Other proteins in same PDB: d1djqa1, d1djqa3, d1djqb1, d1djqb3

Details for d1djqa2

PDB Entry: 1djq (more details), 2.2 Å

PDB Description: structural and biochemical characterization of recombinant c30a mutant of trimethylamine dehydrogenase from methylophilus methylotrophus (sp. w3a1)

SCOP Domain Sequences for d1djqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1}
rwntdgtnclthdpipgadaslpdqltpeqvmdgkkkigkrvvilnadtyfmapslaekl
ataghevtivsgvhlanymhftleypnmmrrlhelhveelgdhfcsriepgrmeiyniwg
dgskrtyrgpgvsprdantshrwiefdslvlvtgrh

SCOP Domain Coordinates for d1djqa2:

Click to download the PDB-style file with coordinates for d1djqa2.
(The format of our PDB-style files is described here.)

Timeline for d1djqa2: