Lineage for d1ujaa_ (1uja A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2064995Protein Influenza neuraminidase [50943] (4 species)
  7. 2065105Species Influenza B virus, different strains [TaxId:11520] [50945] (18 PDB entries)
  8. 2065141Domain d1ujaa_: 1uja A: [303143]
    automated match to d1vcja_
    complexed with iba

Details for d1ujaa_

PDB Entry: 1uja (more details), 2.4 Å

PDB Description: Influenza B virus neuraminidase complexed with 1-(4-Carboxy-2-(3-pentylamino)phenyl)-5-aminomethyl-5-hydroxymethyl-pyrrolidin-2-one
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d1ujaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ujaa_ b.68.1.1 (A:) Influenza neuraminidase {Influenza B virus, different strains [TaxId: 11520]}
pewtyprlscqgstfqkallisphrfgeikgnsapliirepfvacgpkecrhfalthyaa
qpggyyngtrkdrnklrhlvsvklgkiptvensifhmaawsgsachdgrewtyigvdgpd
ndalvkikygeaytdtyhsyahnilrtqesacnciggdcylmitdgsasgiskcrflkir
egriikeilptgrvehteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirlm
ctktyldtprpddgsiagpcesngdkwlggikggfvhqrmaskigrwysrtmsktnrmgm
elyvrydgdpwtdsdaltlsgvmvsieepgwysfgfeikdkkcdvpcigiemvhdggkdt
whsaataiyclmgsgqllwdtvtgvdmal

SCOPe Domain Coordinates for d1ujaa_:

Click to download the PDB-style file with coordinates for d1ujaa_.
(The format of our PDB-style files is described here.)

Timeline for d1ujaa_:

  • d1ujaa_ is new in SCOPe 2.06-stable