Lineage for d1uf6a_ (1uf6 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. Superfamily b.61.6: YceI-like [101874] (2 families) (S)
  5. Family b.61.6.1: YceI-like [101875] (2 proteins)
    Pfam PF04264
  6. Protein Polyisoprenoid-binding protein TTHA0802 (TT1927B) [101876] (1 species)
  7. Species Thermus thermophilus [TaxId:274] [101877] (2 PDB entries)
    Uniprot P83815
    structural genomics
  8. Domain d1uf6a_: 1uf6 A: [303138]
    automated match to d1wuba_

Details for d1uf6a_

PDB Entry: 1uf6 (more details), 1.65 Å

PDB Description: Crystal structure of the conserved hypothetical protein TT1927b from Thermus thermophilus HB8
PDB Compounds: (A:) conserved hypothetical protein TT1927b

SCOPe Domain Sequences for d1uf6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uf6a_ b.61.6.1 (A:) Polyisoprenoid-binding protein TTHA0802 (TT1927B) {Thermus thermophilus [TaxId: 274]}
mkwnldpshtsidfkvrhmgiasvrgslkvlsgsvetdeagrpiqveavidaasiatgep
qrdghlrsadflhaeqypeirfvstqieplggnryriqgnltirditkpvtleaevsapi
kdpwgmqrvaasasgqinrkdwnltwnqvlelgallvgeevkfnleveavapapva

SCOPe Domain Coordinates for d1uf6a_ are not available.

Timeline for d1uf6a_: