Lineage for d1uaha_ (1uah A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2082923Protein Beta-glucosidase A [51528] (9 species)
  7. 2082984Species Thermus thermophilus [TaxId:274] [89476] (2 PDB entries)
  8. 2082986Domain d1uaha_: 1uah A: [303137]
    automated match to d1ug6a_
    complexed with gol

Details for d1uaha_

PDB Entry: 1uah (more details), 0.99 Å

PDB Description: Structure of beta-Glucosidase at atomic resolution from Thermus thermophilus HB8
PDB Compounds: (A:) beta-glycosidase

SCOPe Domain Sequences for d1uaha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uaha_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]}
naekflwgvatsayqiegatqedgrgpsiwdafaqrpgairdgstgepacdhyrryeedi
almqslgvrayrfsvawprilpegrgrinpkglafydrlvdrllasgitpfltlyhwdlp
laleerggwrsretafafaeyaeavaraladrvpffatlnepwcsaflghwtgehapglr
nleaalraahhlllghglavealraagarrvgivlnfapaygedpeavdvadryhnrffl
dpilgkgypespfrdpppvpilsrdlelvarpldflgvnyyapvrvapgtgtlpvrylpp
egpatamgwevypeglyhllkrlgrevpwplyvtengaaypdlwtgeavvedpervayle
ahveaalrareegvdlrgyfvwslmdnfewafgytrrfglyyvdfpsqrripkrsalwyr
eriara

SCOPe Domain Coordinates for d1uaha_:

Click to download the PDB-style file with coordinates for d1uaha_.
(The format of our PDB-style files is described here.)

Timeline for d1uaha_:

  • d1uaha_ is new in SCOPe 2.06-stable