Lineage for d1ty6a_ (1ty6 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066356Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) (S)
  5. 2066357Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 protein domains)
  6. 2066358Protein Integrin alpha N-terminal domain [69320] (2 species)
  7. 2066359Species Human (Homo sapiens), isoform IIb [TaxId:9606] [117285] (24 PDB entries)
    Uniprot P08514 32-483
  8. 2066386Domain d1ty6a_: 1ty6 A: [303126]
    Other proteins in same PDB: d1ty6b4, d1ty6b5, d1ty6b6, d1ty6l3, d1ty6l4
    automated match to d1tyee_
    complexed with ca, gol, mg, nag, ndg

Details for d1ty6a_

PDB Entry: 1ty6 (more details), 2.9 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
PDB Compounds: (A:) integrin alpha-IIb

SCOPe Domain Sequences for d1ty6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ty6a_ b.69.8.1 (A:) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform IIb [TaxId: 9606]}
lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlraeqmasyfghsvavtdvng
dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
lrgavdiddngypdlivgayganqvavyraqp

SCOPe Domain Coordinates for d1ty6a_:

Click to download the PDB-style file with coordinates for d1ty6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ty6a_:

  • d1ty6a_ is new in SCOPe 2.06-stable