Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries) |
Domain d1ty5l4: 1ty5 L:108-214 [303125] Other proteins in same PDB: d1ty5a_, d1ty5b4, d1ty5b5, d1ty5b6, d1ty5l3 automated match to d1tqbc2 complexed with agg, ca, gol, mg, nag, ndg |
PDB Entry: 1ty5 (more details), 2.9 Å
SCOPe Domain Sequences for d1ty5l4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ty5l4 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1ty5l4:
View in 3D Domains from other chains: (mouse over for more information) d1ty5a_, d1ty5b4, d1ty5b5, d1ty5b6 |