SCOPe 2.08: Domain d1ty5l3: 1ty5 L:1-107

Lineage for d1ty5l3 (1ty5 L:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d1ty5l3: 1ty5 L:1-107 [303124]
   Other proteins in same PDB: d1ty5a_, d1ty5b4, d1ty5b5, d1ty5b6, d1ty5h_, d1ty5l4
   automated match to d1a5fl1
   complexed with agg, ca, gol, mg, nag, ndg

Details for d1ty5l3

PDB Entry: 1ty5, 2.9 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen

PDB Compounds: (L:) monoclonal antibody 10e5 light chain

SCOPe Domain Sequences for d1ty5l3:

Sequence; same for both SEQRES and ATOM records:

>d1ty5l3 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps
rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleik

Timeline for d1ty5l3:

• d1ty5l3 first appeared in SCOPe 2.06
  
• d1ty5l3 appears in SCOPe 2.07