Lineage for d1ty5b5 (1ty5 B:58-106,B:355-440)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764933Superfamily b.1.15: Integrin domains [69179] (2 families) (S)
  5. 2764934Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 2764935Protein Hybrid domain of integrin beta [69183] (1 species)
  7. 2764936Species Human (Homo sapiens) [TaxId:9606] [69184] (9 PDB entries)
    Uniprot P05106 27-466
  8. 2764940Domain d1ty5b5: 1ty5 B:58-106,B:355-440 [303122]
    Other proteins in same PDB: d1ty5a_, d1ty5b4, d1ty5b6, d1ty5h_, d1ty5l3, d1ty5l4
    automated match to d1tyed1
    complexed with agg, ca, gol, mg, nag, ndg

Details for d1ty5b5

PDB Entry: 1ty5 (more details), 2.9 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
PDB Compounds: (B:) integrin beta-3

SCOPe Domain Sequences for d1ty5b5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ty5b5 b.1.15.1 (B:58-106,B:355-440) Hybrid domain of integrin beta {Human (Homo sapiens) [TaxId: 9606]}
vsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrdlpe
elslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgfkds
livqvtfdcdcacqaq

SCOPe Domain Coordinates for d1ty5b5:

Click to download the PDB-style file with coordinates for d1ty5b5.
(The format of our PDB-style files is described here.)

Timeline for d1ty5b5: