SCOPe 2.08: Domain d1txwm_: 1txw M:

Lineage for d1txwm_ (1txw M:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (4 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81478] (21 PDB entries)

8. Domain d1txwm_: 1txw M: [303113]
   Other proteins in same PDB: d1txwc_, d1txwh1, d1txwh2, d1txwl_
   automated match to d6prcm_
   complexed with bcb, bpb, fe2, hem, lda, mq9, ns5, so4, uq2

Details for d1txwm_

PDB Entry: 1txw, 2.1 Å

PDB Description: photosynthetic reaction center blastochloris viridis (atcc)

PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d1txwm_:

Sequence; same for both SEQRES and ATOM records:

>d1txwm_ f.26.1.1 (M:) M (medium) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

Timeline for d1txwm_:

• d1txwm_ first appeared in SCOPe 2.06
  
• d1txwm_ appears in SCOPe 2.07