SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1txwh2 (1txw H:37-258)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2052955Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2052956Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2052957Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 protein domains)
  6. 2052958Protein Photosynthetic reaction centre [50348] (4 species)
  7. 2053051Species Rhodopseudomonas viridis [TaxId:1079] [50349] (17 PDB entries)
  8. 2053056Domain d1txwh2: 1txw H:37-258 [303111]
    Other proteins in same PDB: d1txwc_, d1txwh1, d1txwl_, d1txwm_
    automated match to d6prch1
    complexed with bcb, bpb, fe2, hem, lda, mq9, ns5, so4, uq2

Details for d1txwh2

PDB Entry: 1txw (more details), 2.1 Å

PDB Description: photosynthetic reaction center blastochloris viridis (atcc)
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d1txwh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txwh2 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis [TaxId: 1079]}
rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf
egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp
vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilse
qfanvprlqsrdqitlreedkvsayyaggllyatperaesll

SCOPe Domain Coordinates for d1txwh2:

Click to download the PDB-style file with coordinates for d1txwh2.
(The format of our PDB-style files is described here.)

Timeline for d1txwh2:

  • d1txwh2 is new in SCOPe 2.06-stable