Lineage for d1txwh2 (1txw H:37-258)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2052955Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2052956Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2052957Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 protein domains)
  6. 2052958Protein Photosynthetic reaction centre [50348] (4 species)
  7. 2053051Species Rhodopseudomonas viridis [TaxId:1079] [50349] (19 PDB entries)
  8. 2053056Domain d1txwh2: 1txw H:37-258 [303111]
    Other proteins in same PDB: d1txwc_, d1txwh1, d1txwl_, d1txwm_
    automated match to d6prch1
    complexed with bcb, bpb, fe2, hem, lda, mq9, ns5, so4, uq2

Details for d1txwh2

PDB Entry: 1txw (more details), 2.1 Å

PDB Description: photosynthetic reaction center blastochloris viridis (atcc)
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d1txwh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txwh2 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis [TaxId: 1079]}
rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf
egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp
vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilse
qfanvprlqsrdqitlreedkvsayyaggllyatperaesll

SCOPe Domain Coordinates for d1txwh2:

Click to download the PDB-style file with coordinates for d1txwh2.
(The format of our PDB-style files is described here.)

Timeline for d1txwh2:

  • d1txwh2 is new in SCOPe 2.06-stable