Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) |
Family c.2.1.8: CoA-binding domain [51900] (2 proteins) |
Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (3 species) |
Species Pig (Sus scrofa) [TaxId:9823] [51903] (2 PDB entries) |
Domain d1euca1: 1euc A:1-130 [30311] Other proteins in same PDB: d1euca2, d1eucb1, d1eucb2 complexed with po4, so4, zn; mutant |
PDB Entry: 1euc (more details), 2.1 Å
SCOP Domain Sequences for d1euca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa)} csytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpv fntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrll rqgktrligp
Timeline for d1euca1: