Lineage for d1euca1 (1euc A:1-130)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20767Family c.2.1.8: Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51900] (1 protein)
  6. 20768Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (2 species)
  7. 20778Species Pig (Sus scrofa) [TaxId:9823] [51903] (2 PDB entries)
  8. 20779Domain d1euca1: 1euc A:1-130 [30311]
    Other proteins in same PDB: d1euca2, d1eucb1, d1eucb2

Details for d1euca1

PDB Entry: 1euc (more details), 2.1 Å

PDB Description: crystal structure of dephosphorylated pig heart, gtp-specific succinyl-coa synthetase

SCOP Domain Sequences for d1euca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa)}
csytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpv
fntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrll
rqgktrligp

SCOP Domain Coordinates for d1euca1:

Click to download the PDB-style file with coordinates for d1euca1.
(The format of our PDB-style files is described here.)

Timeline for d1euca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1euca2