SCOPe 2.08: Domain d1euca1: 1euc A:1-130

Lineage for d1euca1 (1euc A:1-130)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.8: CoA-binding domain [51900] (6 proteins)

6. Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (6 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51903] (13 PDB entries)

8. Domain d1euca1: 1euc A:1-130 [30311]
   Other proteins in same PDB: d1euca2, d1eucb1, d1eucb2, d1eucb3
   complexed with po4, so4, zn

Details for d1euca1

PDB Entry: 1euc, 2.1 Å

PDB Description: crystal structure of dephosphorylated pig heart, gtp-specific succinyl-coa synthetase

PDB Compounds: (A:) succinyl-coa synthetase, alpha chain

SCOPe Domain Sequences for d1euca1:

Sequence; same for both SEQRES and ATOM records:

>d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]}
csytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpv
fntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrll
rqgktrligp

Timeline for d1euca1:

• d1euca1 first appeared (with stable ids) in SCOP 1.55
  
• d1euca1 appears in SCOPe 2.07