Lineage for d1txwc_ (1txw C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734274Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins)
    consists of four heme-binding repeats
    automatically mapped to Pfam PF02276
  6. 2734307Protein automated matches [227073] (3 species)
    not a true protein
  7. 2734311Species Rhodopseudomonas viridis [TaxId:1079] [311178] (1 PDB entry)
  8. 2734312Domain d1txwc_: 1txw C: [303109]
    Other proteins in same PDB: d1txwh1, d1txwh2, d1txwl_, d1txwm_
    automated match to d3t6dc_
    complexed with bcb, bpb, fe2, hem, lda, mq9, ns5, so4, uq2

Details for d1txwc_

PDB Entry: 1txw (more details), 2.1 Å

PDB Description: photosynthetic reaction center blastochloris viridis (atcc)
PDB Compounds: (C:) Photosynthetic reaction center cytochrome c subunit

SCOPe Domain Sequences for d1txwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txwc_ a.138.1.2 (C:) automated matches {Rhodopseudomonas viridis [TaxId: 1079]}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

SCOPe Domain Coordinates for d1txwc_:

Click to download the PDB-style file with coordinates for d1txwc_.
(The format of our PDB-style files is described here.)

Timeline for d1txwc_: