SCOPe 2.07: Domain d1txwc_: 1txw C:

Lineage for d1txwc_ (1txw C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins)
   consists of four heme-binding repeats
   automatically mapped to Pfam PF02276

6. Protein automated matches [227073] (3 species)
   not a true protein

7. Species Rhodopseudomonas viridis [TaxId:1079] [311178] (1 PDB entry)

8. Domain d1txwc_: 1txw C: [303109]
   Other proteins in same PDB: d1txwh1, d1txwh2, d1txwl_, d1txwm_
   automated match to d3t6dc_
   complexed with bcb, bpb, fe2, hem, lda, mq9, ns5, so4, uq2

Details for d1txwc_

PDB Entry: 1txw, 2.1 Å

PDB Description: photosynthetic reaction center blastochloris viridis (atcc)

PDB Compounds: (C:) Photosynthetic reaction center cytochrome c subunit

SCOPe Domain Sequences for d1txwc_:

Sequence; same for both SEQRES and ATOM records:

>d1txwc_ a.138.1.2 (C:) automated matches {Rhodopseudomonas viridis [TaxId: 1079]}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

Timeline for d1txwc_:

• d1txwc_ first appeared in SCOPe 2.06