![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
![]() | Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins) consists of four heme-binding repeats automatically mapped to Pfam PF02276 |
![]() | Protein automated matches [227073] (3 species) not a true protein |
![]() | Species Rhodopseudomonas viridis [TaxId:1079] [311178] (1 PDB entry) |
![]() | Domain d1txwc_: 1txw C: [303109] Other proteins in same PDB: d1txwh1, d1txwh2, d1txwl_, d1txwm_ automated match to d3t6dc_ complexed with bcb, bpb, fe2, hem, lda, mq9, ns5, so4, uq2 |
PDB Entry: 1txw (more details), 2.1 Å
SCOPe Domain Sequences for d1txwc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1txwc_ a.138.1.2 (C:) automated matches {Rhodopseudomonas viridis [TaxId: 1079]} cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea pqadcrtchqgvtkplfgasrlkdypelgpik
Timeline for d1txwc_:
![]() Domains from other chains: (mouse over for more information) d1txwh1, d1txwh2, d1txwl_, d1txwm_ |