Lineage for d1txvb4 (1txv B:1-57)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033514Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies)
    disulfide-rich fold; common core is alpha+beta with two conserved disulfides
  4. 3033549Superfamily g.16.2: Plexin repeat [103575] (1 family) (S)
  5. 3033550Family g.16.2.1: Plexin repeat [103576] (3 proteins)
    Pfam PF01437
  6. 3033556Protein Integrin beta-3 [118249] (1 species)
  7. 3033557Species Human (Homo sapiens) [TaxId:9606] [118250] (6 PDB entries)
    Uniprot P05106 27-716 ! Uniprot P05106 27-466
  8. 3033558Domain d1txvb4: 1txv B:1-57 [303104]
    Other proteins in same PDB: d1txva_, d1txvb5, d1txvb6, d1txvh_, d1txvl3, d1txvl4
    automated match to d1tyed3
    complexed with ca, cac, gol, mg, nag, ndg

Details for d1txvb4

PDB Entry: 1txv (more details), 2.75 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
PDB Compounds: (B:) integrin beta-3

SCOPe Domain Sequences for d1txvb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txvb4 g.16.2.1 (B:1-57) Integrin beta-3 {Human (Homo sapiens) [TaxId: 9606]}
gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefp

SCOPe Domain Coordinates for d1txvb4:

Click to download the PDB-style file with coordinates for d1txvb4.
(The format of our PDB-style files is described here.)

Timeline for d1txvb4: