Lineage for d1cqid1 (1cqi D:1-121)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20767Family c.2.1.8: Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51900] (1 protein)
  6. 20768Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (2 species)
  7. 20769Species Escherichia coli [TaxId:562] [51902] (4 PDB entries)
  8. 20777Domain d1cqid1: 1cqi D:1-121 [30310]
    Other proteins in same PDB: d1cqia2, d1cqib1, d1cqib2, d1cqid2, d1cqie1, d1cqie2

Details for d1cqid1

PDB Entry: 1cqi (more details), 3.3 Å

PDB Description: crystal structure of the complex of adp and mg2+ with dephosphorylated e. coli succinyl-coa synthetase

SCOP Domain Sequences for d1cqid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqid1 c.2.1.8 (D:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli}
silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
p

SCOP Domain Coordinates for d1cqid1:

Click to download the PDB-style file with coordinates for d1cqid1.
(The format of our PDB-style files is described here.)

Timeline for d1cqid1: