SCOPe 2.06: Domain d1tl0k_: 1tl0 K:

Lineage for d1tl0k_ (1tl0 K:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein automated matches [190381] (8 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:37965] [187230] (2 PDB entries)

8. Domain d1tl0k_: 1tl0 K: [303099]
   automated match to d1djrd_

Details for d1tl0k_

PDB Entry: 1tl0, 1.94 Å

PDB Description: Novel carbohydrate binding site identified in a hybrid of cholera toxin and Escherichia coli heat-labile enterotoxin B-subunits: 1.9 crystal structure reveals the details

PDB Compounds: (K:) Cholera enterotoxin subunit B

SCOPe Domain Sequences for d1tl0k_:

Sequence, based on SEQRES records:

>d1tl0k_ b.40.2.1 (K:) automated matches {Vibrio cholerae [TaxId: 37965]}
apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisma

Sequence, based on observed residues (ATOM records):

>d1tl0k_ b.40.2.1 (K:) automated matches {Vibrio cholerae [TaxId: 37965]}
apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvekkaiermkd
tlriaylteakveklcvwnnktpnsiaaisma

Timeline for d1tl0k_:

• d1tl0k_ is new in SCOPe 2.06-stable
  
• d1tl0k_ appears in SCOPe 2.07
  
• d1tl0k_ appears in the current release, SCOPe 2.08