Lineage for d1tl0h_ (1tl0 H:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2058420Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2058912Protein automated matches [190381] (8 species)
    not a true protein
  7. 2059042Species Vibrio cholerae [TaxId:37965] [187230] (2 PDB entries)
  8. 2059045Domain d1tl0h_: 1tl0 H: [303096]
    automated match to d1djrd_

Details for d1tl0h_

PDB Entry: 1tl0 (more details), 1.94 Å

PDB Description: Novel carbohydrate binding site identified in a hybrid of cholera toxin and Escherichia coli heat-labile enterotoxin B-subunits: 1.9 crystal structure reveals the details
PDB Compounds: (H:) Cholera enterotoxin subunit B

SCOPe Domain Sequences for d1tl0h_:

Sequence, based on SEQRES records: (download)

>d1tl0h_ b.40.2.1 (H:) automated matches {Vibrio cholerae [TaxId: 37965]}
apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisma

Sequence, based on observed residues (ATOM records): (download)

>d1tl0h_ b.40.2.1 (H:) automated matches {Vibrio cholerae [TaxId: 37965]}
apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpghidsqk
kaiermkdtlriaylteakveklcvwnnktpnsiaaisma

SCOPe Domain Coordinates for d1tl0h_:

Click to download the PDB-style file with coordinates for d1tl0h_.
(The format of our PDB-style files is described here.)

Timeline for d1tl0h_: