Lineage for d1ti9d_ (1ti9 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715762Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 2715763Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (2 proteins)
  6. 2715775Protein automated matches [191020] (3 species)
    not a true protein
  7. 2715779Species Escherichia coli [311177] (1 PDB entry)
  8. 2715780Domain d1ti9d_: 1ti9 D: [303092]
    automated match to d3k4ga_
    protein/DNA complex; protein/RNA complex

Details for d1ti9d_

PDB Entry: 1ti9 (more details)

PDB Description: A Model of the Ternary Complex Formed Between MarA, the alpha-CTD of RNA polymerase and DNA
PDB Compounds: (D:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d1ti9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ti9d_ a.60.3.1 (D:) automated matches {Escherichia coli}
fdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikdvla
srglslgmrlenwppasiade

SCOPe Domain Coordinates for d1ti9d_:

Click to download the PDB-style file with coordinates for d1ti9d_.
(The format of our PDB-style files is described here.)

Timeline for d1ti9d_: