![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (2 proteins) |
![]() | Protein automated matches [191020] (3 species) not a true protein |
![]() | Species Escherichia coli [311177] (1 PDB entry) |
![]() | Domain d1ti9d_: 1ti9 D: [303092] automated match to d3k4ga_ protein/DNA complex; protein/RNA complex |
PDB Entry: 1ti9 (more details)
SCOPe Domain Sequences for d1ti9d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ti9d_ a.60.3.1 (D:) automated matches {Escherichia coli} fdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikdvla srglslgmrlenwppasiade
Timeline for d1ti9d_: