Lineage for d1teba_ (1teb A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3017418Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 3017426Protein Viral RNA polymerase [56695] (17 species)
  7. 3017665Species Human rhinovirus 14, HRV-14 [TaxId:12131] [111301] (2 PDB entries)
    Uniprot P03303 1720-2179
  8. 3017666Domain d1teba_: 1teb A: [303086]
    automated match to d1xr5a_
    complexed with sm

    missing some secondary structures that made up less than one-third of the common domain

Details for d1teba_

PDB Entry: 1teb (more details), 2.8 Å

PDB Description: Crystal structure of the RNA-dependent RNA polymerase 3D from human rhinovirus serotype 14
PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d1teba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1teba_ e.8.1.4 (A:) Viral RNA polymerase {Human rhinovirus 14, HRV-14 [TaxId: 12131]}
gqviarhkvrefninpvntptksklhpsvfydvfpgdkepavlsdndprlevklteslfs
kykgnvnteptenmlvavdhyagqllsldiptseltlkealygvdglepidittsagfpy
vslgikkrdilnketqdtekmkfyldkygidlplvtyikdelrsvdkvrlgksrlieass
lndsvnmrmklgnlykafhqnpgvltgsavgcdpdvfwsvipclmdghlmafdysnfdas
lspvwfvclekvltklgfagssliqsicnthhifrdeiyvveggmpsgcsgtsifnsmin
niiirtlildaykgidldklkilaygddlivsypyeldpqvlatlgknygltitppdkse
tftkmtwenltflkryfkpdqqfpflvhpvmpmkdihesirwtkdpkntqdhvrslcmla
whsgekeynefiqkirttdigkclilpeysvlrrrwldlf

SCOPe Domain Coordinates for d1teba_:

Click to download the PDB-style file with coordinates for d1teba_.
(The format of our PDB-style files is described here.)

Timeline for d1teba_: