Class a: All alpha proteins [46456] (289 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (3 proteins) Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain |
Protein Hydroxyisobutyrate dehydrogenase [101357] (4 species) forms similar dimeric and tetrameric structures to the 6-phosphogluconate dehydrogenase domain and its dimer, respectively |
Species Salmonella typhimurium [TaxId:90371] [109948] (2 PDB entries) Uniprot Q8ZLV8 |
Domain d1teaa4: 1tea A:164-296 [303085] Other proteins in same PDB: d1teaa3 automated match to d1vpda1 complexed with cl, tar |
PDB Entry: 1tea (more details), 1.65 Å
SCOPe Domain Sequences for d1teaa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1teaa4 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} digagnvtklanqvivalniaamsealtlatkagvnpdlvyqairgglagstvldakapm vmdrnfkpgfridlhikdlanaldtshgvgaqlpltaavmemmqalradghgnddhsala cyyeklakvevtr
Timeline for d1teaa4: