SCOPe 2.08: Domain d1teaa4: 1tea A:164-296

Lineage for d1teaa4 (1tea A:164-296)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (3 proteins)
   Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain

6. Protein Hydroxyisobutyrate dehydrogenase [101357] (4 species)
   forms similar dimeric and tetrameric structures to the 6-phosphogluconate dehydrogenase domain and its dimer, respectively

7. Species Salmonella typhimurium [TaxId:90371] [109948] (2 PDB entries)
   Uniprot Q8ZLV8

8. Domain d1teaa4: 1tea A:164-296 [303085]
   Other proteins in same PDB: d1teaa3
   automated match to d1vpda1
   complexed with cl, tar

Details for d1teaa4

PDB Entry: 1tea, 1.65 Å

PDB Description: X-ray crystal structure of tartronate semialdehyde reductase [Salmonella typhimurium LT2]

PDB Compounds: (A:) tartronate semialdehyde reductase

SCOPe Domain Sequences for d1teaa4:

Sequence; same for both SEQRES and ATOM records:

>d1teaa4 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]}
digagnvtklanqvivalniaamsealtlatkagvnpdlvyqairgglagstvldakapm
vmdrnfkpgfridlhikdlanaldtshgvgaqlpltaavmemmqalradghgnddhsala
cyyeklakvevtr

Timeline for d1teaa4:

• d1teaa4 first appeared in SCOPe 2.06
  
• d1teaa4 appears in SCOPe 2.07